PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 226aa    MW: 26185.4 Da    PI: 9.4349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591955.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-19449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
   XP_013591955.1  4 RGHWRPSEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding58.91.1e-185699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++T++E+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_013591955.1 56 RNPFTEDEEERLLAAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.393150IPR017930Myb domain
SMARTSM007177.2E-16352IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-30497IPR009057Homeodomain-like
PfamPF002491.2E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-27557IPR009057Homeodomain-like
CDDcd001675.11E-15748No hitNo description
PROSITE profilePS5129425.78851105IPR017930Myb domain
SMARTSM007177.7E-1655103IPR001005SANT/Myb domain
PfamPF002492.4E-155698IPR001005SANT/Myb domain
CDDcd001672.04E-125898No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2158104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MCSRGHWRPS EDEKLKDLVE QYGPHNWNAI ALKLPGRSGK SCRLRWFNQL DPRINRNPFT  60
EDEEERLLAA HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRTRQTSK PRILPSMTSS  120
LMATEQTMMG SGDGKRILGD VVNYPYQFSH INHLQFLKEF FTGKIALNTK ENQSKKPIEF  180
YDFLQVDTGS NKSEVIDQDS DQSNPNDSDN KNESHVPFFD FLSVGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-3111051105C-Myb DNA-Binding Domain
1msf_C1e-3111051105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895001e-160AC189500.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB086N06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013701209.11e-171PREDICTED: transcriptional activator Myb-like
RefseqXP_013591955.11e-171PREDICTED: transcriptional activator Myb-like
TrEMBLA0A078CDD91e-171A0A078CDD9_BRANA; BnaC06g34360D protein
TrEMBLA0A0D3D0D41e-171A0A0D3D0D4_BRAOL; Uncharacterized protein
STRINGBra015992.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.11e-130myb domain protein 54